Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AQP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human AQP8 (NP_001160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AQP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human AQP8 (NP_001160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AQP8 |
| Target Synonyms | AQP-8; AQP8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human heart, Human liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AQP8 (NP_001160.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILA | Uniprot ID | O94778 |
Uniprot Id
O94778
Target Species
Human
Target Name
AQP8
Target Full Name
Aquaporin-8
Target Function
Forms a water-specific channel; mercury-sensitive. Not permeable to glycerol or urea.
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Detected in the sperm midpiece (at protein level). Expressed only in pancreas and colon.
Target Synonyms
AQP8; Aquaporin-8; AQP-8
Target Background
Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 8 mRNA is found in pancreas and colon but not other tissues.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
