-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Aquaporin-4 (AQP4) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 244-323 of human Aquaporin-4 (AQP4) (NP_001641.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Aquaporin-4 (AQP4) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 244-323 of human Aquaporin-4 (AQP4) (NP_001641.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05937A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aquaporin-4 (AQP4) |
| Target Synonyms | MIWC; WCH4; hAQP4; Aquaporin-4 (AQP4) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 244-323 of human Aquaporin-4 (AQP4) (NP_001641.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV | Uniprot ID | P55087 |
Uniprot Id
P55087
Target Species
Human
Target Name
AQP4
Target Full Name
Aquaporin-4
Target Function
Forms a water-specific channel. Plays an important role in brain water homeostasis and in glymphatic solute transport. Required for a normal rate of water exchange across the blood brain interface. Required for normal levels of cerebrospinal fluid influx into the brain cortex and parenchyma along paravascular spaces that surround penetrating arteries, and for normal drainage of interstitial fluid along paravenous drainage pathways. Thereby, it is required for normal clearance of solutes from the brain interstitial fluid, including soluble beta-amyloid peptides derived from APP. Plays a redundant role in urinary water homeostasis and urinary concentrating ability.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endosome membrane. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Detected in skeletal muscle. Detected in stomach, along the glandular base region of the fundic gland (at protein level). Detected in brain, lung and skeletal muscle, and at much lower levels in heart and ovary.
Target Research Area
Transport
Target Synonyms
AQP 4; AQP-4; AQP4; AQP4_HUMAN; Aquaporin type 4; Aquaporin-4; Aquaporin4; HMIWC 2; HMIWC2; Mercurial insensitive water channel; Mercurial-insensitive water channel; MGC22454; MIWC; WCH 4; WCH4
Target Background
This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.
Notification