Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARFRP1 / ARP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human ARFRP1 / ARP (Q13795) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ARFRP1 / ARP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human ARFRP1 / ARP (Q13795) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13473A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARFRP1 / ARP |
| Target Synonyms | ARP; Arp1; ARL18; ARFRP1 / ARP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HepG2, Mouse liver, PC-3, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 102-201 of human ARFRP1 / ARP (Q13795). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT | Uniprot ID | Q13795 |
Uniprot Id
Q13795
Target Species
Human
Target Name
ARFRP1
Target Full Name
ADP-ribosylation factor-related protein 1
Target Function
Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver.
Target Subcellular Location
Golgi apparatus. Golgi apparatus, trans-Golgi network.
Target Protein Families
Small GTPase superfamily, Arf family
Target Tissue Specificity
Found in most tissues.
Target Synonyms
ADP ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARF related protein 1; ARF related protein; ARF-related protein 1; ARFRP_HUMAN; ARFRP1; ARL 18; ARL18; ARP 1; ARP; ARP1; Helicase like protein NHL; MGC6837; SCG10 like protein
Target Background
The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
