Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARHGAP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-650 of human ARHGAP22 (NP_001242953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARHGAP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-650 of human ARHGAP22 (NP_001242953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00203A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARHGAP22 |
| Target Synonyms | RhoGAP2; RhoGap22; ARHGAP22 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, Rat kidney, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-650 of human ARHGAP22 (NP_001242953.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKR | Uniprot ID | Q7Z5H3 |
Uniprot Id
Q7Z5H3
Target Species
Human
Target Name
ARHGAP22
Target Full Name
Rho GTPase-activating protein 22
Target Function
Rho GTPase-activating protein involved in the signal transduction pathway that regulates endothelial cell capillary tube formation during angiogenesis. Acts as a GTPase activator for the RAC1 by converting it to an inactive GDP-bound state. Inhibits RAC1-dependent lamellipodia formation. May also play a role in transcription regulation via its interaction with VEZF1, by regulating activity of the endothelin-1 (EDN1) promoter.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Synonyms
ARHGAP22; RHG22_HUMAN; Rho GTPase activating protein 2; Rho GTPase activating protein 22; Rho GTPase-activating protein 22; Rho type GTPase activating protein 22; Rho-type GTPase-activating protein 22; RhoGAP2; RhoGap22
Target Background
This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kinase Akt and requires the Akt-dependent 14-3-3 binding protein which binds sequentially to two serine residues. The result of these interactions is regulation of cell motility. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
