-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARHGAP45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ARHGAP45 (NP_036424.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARHGAP45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ARHGAP45 (NP_036424.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01527A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARHGAP45 |
| Target Synonyms | HA-1; HMHA1; HLA-HA1; ARHGAP45 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, LO2, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ARHGAP45 (NP_036424.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRV | Uniprot ID | Q92619 |
Uniprot Id
Q92619
Target Species
Human
Target Name
ARHGAP45
Target Full Name
Rho GTPase-activating protein 45
Target Function
Contains a GTPase activator for the Rho-type GTPases (RhoGAP) domain that would be able to negatively regulate the actin cytoskeleton as well as cell spreading. However, also contains N-terminally a BAR-domin which is able to play an autoinhibitory effect on this RhoGAP activity.; Precursor of the histocompatibility antigen HA-1. More generally, minor histocompatibility antigens (mHags) refer to immunogenic peptide which, when complexed with MHC, can generate an immune response after recognition by specific T-cells. The peptides are derived from polymorphic intracellular proteins, which are cleaved by normal pathways of antigen processing. The binding of these peptides to MHC class I or class II molecules and its expression on the cell surface can stimulate T-cell responses and thereby trigger graft rejection or graft-versus-host disease (GVHD) after hematopoietic stem cell transplantation from HLA-identical sibling donor. GVHD is a frequent complication after bone marrow transplantation (BMT), due to mismatch of minor histocompatibility antigen in HLA-matched sibling marrow transplants. Specifically, mismatching for mHag HA-1 which is recognized as immunodominant, is shown to be associated with the development of severe GVHD after HLA-identical BMT. HA-1 is presented to the cell surface by MHC class I HLA-A*0201, but also by other HLA-A alleles. This complex specifically elicits donor-cytotoxic T-lymphocyte (CTL) reactivity against hematologic malignancies after treatment by HLA-identical allogenic BMT. It induces cell recognition and lysis by CTL.
Target Subcellular Location
Cytoplasm. Cell projection, ruffle membrane.
Target Tissue Specificity
Expressed on cells of the hematopoietic lineage. Detected in dendritic cells and epidermal Langerhans cells. Expressed in peripheral blood mononuclear cells, in all leukemia/lymphoma cell lines. Detected also in some solid tumors and tissues such as cance
Target Synonyms
HLA HA1; hmha1; HMHA1_HUMAN; KIAA0223; mHag HA-1; Minor histocompatibility antigen HA 1; Minor histocompatibility antigen HA-1; Minor histocompatibility protein HA 1
Target Background
Predicted to enable GTPase activator activity. Predicted to be involved in activation of GTPase activity. Located in membrane.
Notification