-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARL2BP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL2BP (NP_036238.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARL2BP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL2BP (NP_036238.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05244A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARL2BP |
| Target Synonyms | BART; RP66; BART1; ARL2BP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL2BP (NP_036238.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHH | Uniprot ID | Q9Y2Y0 |
Uniprot Id
Q9Y2Y0
Target Species
Human
Target Name
ARL2BP
Target Full Name
ADP-ribosylation factor-like protein 2-binding protein
Target Function
Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
Target Involvement
Retinitis pigmentosa with or without situs inversus (RPSI)
Target Subcellular Location
Cytoplasm. Mitochondrion intermembrane space. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, cilium basal body.
Target Protein Families
ARL2BP family
Target Tissue Specificity
Expressed in retina pigment epithelial cells (at protein level). Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
ADP ribosylation factor like 2 binding protein; ADP-ribosylation factor-like protein 2-binding protein; AR2BP_HUMAN; Arf like 2 binding protein BART1; ARF-like 2-binding protein; ARL2 binding protein; Arl2bp; ARL2BP protein; BART; BART1; Binder of ARF2 protein 1; Binder of Arl Two; Binder of Arl2; Retinitis pigmentosa 66 (autosomal recessive); RP66
Target Background
ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity.
Notification