-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARL6IP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL6IP1 (NP_055976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ARL6IP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL6IP1 (NP_055976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05836A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARL6IP1 |
| Target Synonyms | AIP1; ARMER; SPG61; ARL6IP; ARL6IP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, K-562 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARL6IP1 (NP_055976.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE | Uniprot ID | Q15041 |
Uniprot Id
Q15041
Target Species
Human
Target Name
ARL6IP1
Target Full Name
ADP-ribosylation factor-like protein 6-interacting protein 1
Target Function
Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport. Plays a role in the formation and stabilization of endoplasmic reticulum tubules. Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9). Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself. May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.
Target Involvement
Spastic paraplegia 61, autosomal recessive (SPG61)
Target Subcellular Location
Endomembrane system; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Target Protein Families
ARL6ip family
Target Tissue Specificity
Expressed in all hematopoietic cell lineages, but the highest level of expression is found in early myeloid progenitor cells. Expressed in brain, bone marrow, thymus and lung. Expressed at low level in liver, kidney and spleen. Not detected in heart.
Target Synonyms
ARL6IP1; ARL6IP; ARMER; KIAA0069; ADP-ribosylation factor-like protein 6-interacting protein 1; ARL-6-interacting protein 1; Aip-1; Apoptotic regulator in the membrane of the endoplasmic reticulum
Target Background
This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.
Notification