Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARL6IP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against ARL6IP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of ARL6IP4 in paraffin-embedded human lung using ARL6IP4 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-06110A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARL6IP4 |
| Target Synonyms | SR-25; SRp25; SFRS20; SRrp37; ARL6IP4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP | Uniprot ID | Q66PJ3 |
Uniprot Id
Q66PJ3
Target Species
Human
Target Name
ARL6IP4
Target Full Name
ADP-ribosylation factor-like protein 6-interacting protein 4
Target Function
Involved in modulating alternative pre-mRNA splicing with either 5' distal site activation or preferential use of 3' proximal site. In case of infection by Herpes simplex virus (HSVI), may act as a splicing inhibitor of HSVI pre-mRNA.
Target Subcellular Location
Nucleus, nucleolus. Nucleus speckle.
Target Protein Families
ARL6IP4 family
Target Tissue Specificity
Isoforms 3 and 7 were identified in brain, pancreas, prostate, and testis, but little or no message could be detected in other tissues.
Target Synonyms
ARL6IP4ADP-ribosylation factor-like protein 6-interacting protein 4; ARL-6-interacting protein 4; Aip-4; HSP-975; HSVI-binding protein; SR-15; SRp25; SR-25; Splicing factor SRrp37
Target Background
Enables identical protein binding activity. Predicted to be involved in RNA splicing and mRNA processing. Predicted to be located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
