Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARMC10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 169-308 of human ARMC10 (NP_001154481.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARMC10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 169-308 of human ARMC10 (NP_001154481.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07653A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARMC10 |
| Target Synonyms | SVH; PNAS112; PNAS-112; PSEC0198; ARMC10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 169-308 of human ARMC10 (NP_001154481.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI | Uniprot ID | Q8N2F6 |
Uniprot Id
Q8N2F6
Target Species
Human
Target Name
ARMC10
Target Full Name
Armadillo repeat-containing protein 10
Target Function
May play a role in cell survival and cell growth. May suppress the transcriptional activity of p53/TP53.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Tissue Specificity
Expressed in all tissues tested with higher expression in placenta, liver, kidney, heart and brain.
Target Synonyms
ARM10_HUMAN; Armadillo repeat containing 10; Armadillo repeat containing protein 10; Armadillo repeat-containing protein 10; ARMC 10; ARMC10; FLJ37850; MGC3195; PNAS112; Specific splicing variant involved in hepatocarcinogenesis; Splicing variant involved in hepatocarcinogenesis protein; SVH
Target Background
This gene encodes a protein that contains an armadillo repeat and transmembrane domain. The encoded protein decreases the transcriptional activity of the tumor suppressor protein p53 through direct interaction with the DNA-binding domain of p53, and may play a role in cell growth and survival. Upregulation of this gene may play a role in hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
