-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against ARPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-14412A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARPC2 |
| Target Synonyms | ARC34; PRO2446; p34-Arc; PNAS-139; ARPC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse spleen, Mouse stomach, Mouse thymus, Rat lung | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR | Uniprot ID | O15144 |
Uniprot Id
O15144
Target Species
Human
Target Name
ARPC2
Target Full Name
Actin-related protein 2/3 complex subunit 2
Target Function
Actin-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the mother actin filament. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs).
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection. Cell junction, synapse, synaptosome. Nucleus.
Target Protein Families
ARPC2 family
Target Research Area
Signal Transduction
Target Synonyms
Actin related protein 2/3 complex subunit 2 34kDa; Actin related protein 2/3 complex subunit 2; Actin-related protein 2/3 complex subunit 2; ARC 34; ARC34; Arp2/3 complex 34 kDa subunit; ARP2/3 protein compex subunit 34 ; ARPC 2; Arpc2; ARPC2_HUMAN; p34 Arc; p34-ARC; p34Arc; PNAS 139; PNAS139; PRO 2446 ; PRO2446
Target Background
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.
Notification