Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARRDC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRDC4 (NP_899232.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARRDC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRDC4 (NP_899232.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10570A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARRDC4 |
| Target Synonyms | ARRDC4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRDC4 (NP_899232.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSE | Uniprot ID | Q8NCT1 |
Uniprot Id
Q8NCT1
Target Species
Human
Target Name
ARRDC4
Target Full Name
Arrestin domain-containing protein 4
Target Function
Functions as an adapter recruiting ubiquitin-protein ligases to their specific substrates. Plays a role in endocytosis of activated G protein-coupled receptors (GPCRs) (Probable). Through an ubiquitination-dependent mechanism plays also a role in the incorporation of SLC11A2 into extracellular vesicles. May play a role in glucose uptake.
Target Subcellular Location
Early endosome. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle.
Target Protein Families
Arrestin family
Target Synonyms
ARRD4_HUMAN; ARRDC 4; Arrdc4; Arrestin domain containing protein 4; Arrestin domain-containing protein 4; FLJ36045
Target Background
Predicted to enable ubiquitin ligase-substrate adaptor activity. Acts upstream of or within positive regulation of ubiquitin-protein transferase activity. Located in endosome and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
