Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARSB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 404-533 of human ARSB (NP_000037.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARSB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 404-533 of human ARSB (NP_000037.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05784A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARSB |
| Target Synonyms | ASB; G4S; MPS6; ARSB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 404-533 of human ARSB (NP_000037.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM | Uniprot ID | P15848 |
Uniprot Id
P15848
Target Species
Human
Target Name
ARSB
Target Full Name
Arylsulfatase B
Target Function
Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation. Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium. In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels.
Target Involvement
Mucopolysaccharidosis 6 (MPS6); Multiple sulfatase deficiency (MSD)
Target Subcellular Location
Lysosome. Cell surface.
Target Protein Families
Sulfatase family
Target Research Area
Cancer
Target Synonyms
Arsb; ARSB_HUMAN; Arylsulfatase B; ArylsulfataseB; ASB; G4S; MPS6; N acetylgalactosamine 4 sulfatase; N-acetylgalactosamine-4-sulfatase
Target Background
Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
