Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ART3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human ART3 (NP_001123488) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ART3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human ART3 (NP_001123488) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07999A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ART3 |
| Target Synonyms | ARTC3; ART3 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | OVCAR-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human ART3 (NP_001123488). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLR | Uniprot ID | Q13508 |
Uniprot Id
Q13508
Target Species
Human
Target Name
ART3
Target Full Name
Ecto-ADP-ribosyltransferase 3
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Arg-specific ADP-ribosyltransferase family
Target Tissue Specificity
Testis specific.
Target Synonyms
ADP ribosyltransferase 3; ART 3; Art3; Ecto-ADP-ribosyltransferase 3; FLJ26404; mono ADP ribosyltransferase; Mono(ADP-ribosyl)transferase 3; NAD(P)(+)--arginine ADP-ribosyltransferase 3; NAR3_HUMAN; OTTHUMP00000160603; OTTHUMP00000160604; OTTHUMP00000219067; OTTHUMP00000219069; OTTHUMP00000219070; TMART
Target Background
This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
