-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARTN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 122-220 of human ARTN (NP_476432.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARTN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 122-220 of human ARTN (NP_476432.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01856A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARTN |
| Target Synonyms | ART; EVN; NBN; ENOVIN; ARTN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 122-220 of human ARTN (NP_476432.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG | Uniprot ID | Q5T4W7 |
Uniprot Id
Q5T4W7
Target Species
Human
Target Name
ARTN
Target Full Name
Artemin
Target Function
Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue.
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family, GDNF subfamily
Target Tissue Specificity
Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain.
Target Research Area
Neuroscience
Target Synonyms
Artemin; Artn; ARTN_HUMAN; Enovin; EVN; NBN; Neublastin; Neurotrophic factor
Target Background
This gene encodes a secreted ligand of the glial cell line-derived neurotrophic factor (GDNF) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein signals through the RET receptor and GFR alpha 3 coreceptor, and supports the survival of a number of peripheral neuron populations and at least one population of dopaminergic CNS neurons. This protein has also been shown to promote tumor growth, metastasis, and drug resistance in mammary carcinoma.
Notification