Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASB17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human ASB17 (NP_543144.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ASB17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human ASB17 (NP_543144.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07158A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASB17 |
| Target Synonyms | Asb-17; ASB17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human ASB17 (NP_543144.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSLQFLGQWGYHCYEPRIYRSLAKILRYVDLDGFDALLTDYIAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCNLA | Uniprot ID | Q8WXJ9 |
Uniprot Id
Q8WXJ9
Target Species
Human
Target Name
ASB17
Target Full Name
Ankyrin repeat and SOCS box protein 17
Target Function
May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Target Protein Families
Ankyrin SOCS box (ASB) family
Target Tissue Specificity
Specifically expressed in testis. Not detected in other tissues tested.
Target Synonyms
ASB17; Ankyrin repeat and SOCS box protein 17; ASB-17
Target Background
Predicted to be involved in intracellular signal transduction and protein ubiquitination. Predicted to be located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
