-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASH2L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 529-628 of human ASH2L (Q9UBL3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ASH2L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 529-628 of human ASH2L (Q9UBL3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16607A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASH2L |
| Target Synonyms | ASH2; Bre2; ASH2L1; ASH2L2; ASH2L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse testis, PC-3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 529-628 of human ASH2L (Q9UBL3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP | Uniprot ID | Q9UBL3 |
Uniprot Id
Q9UBL3
Target Species
Human
Target Name
ASH2L
Target Full Name
Set1/Ash2 histone methyltransferase complex subunit ASH2
Target Function
Transcriptional regulator. Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters. Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May play a role in hematopoiesis. In association with RBBP5 and WDR5, stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A and SETD1B.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes.
Target Research Area
Transcription
Target Synonyms
ASH 2; Ash2 (absent small or homeotic) like; Ash2 (absent; small; or homeotic) like (Drosophila); ASH2; ASH2 LIKE; ASH2 like protein; ASH2-like protein; Ash2l; ASH2L_HUMAN; ASH2L1 ; ASH2L2; Bre 2; Bre2; Discs 2-like; Drosophila absent; small; or homeotic; Drosophila ASH2-like; Set1/Ash2 histone methyltransferase complex subunit ASH2
Target Background
Enables beta-catenin binding activity and transcription cis-regulatory region binding activity. Contributes to histone methyltransferase activity (H3-K4 specific). Involved in histone H3-K4 methylation; positive regulation of cell population proliferation; and response to estrogen. Acts upstream of or within cellular response to DNA damage stimulus. Located in nucleus. Part of MLL3/4 complex and Set1C/COMPASS complex.
Notification