-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-132 of human ASIP (NP_001663.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against ASIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-132 of human ASIP (NP_001663.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-02815A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASIP |
| Target Synonyms | ASP; AGSW; AGTI; AGTIL; SHEP9; ASIP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-132 of human ASIP (NP_001663.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC | Uniprot ID | P42127 |
Uniprot Id
P42127
Target Species
Human
Target Name
ASIP
Target Full Name
Agouti-signaling protein
Target Function
Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed in adipose tissue, testis, ovary and heart and at lower levels in liver, kidney and foreskin.
Target Research Area
Neuroscience
Target Synonyms
ASIP; AGTI; AGTIL; ASP; Agouti-signaling protein; ASP; Agouti switch protein
Target Background
In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes.
Notification