Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASNS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human ASNS (P08243) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ASNS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human ASNS (P08243) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13743A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASNS |
| Target Synonyms | TS11; ASNSD; ASNS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse liver, Rat liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ASNS (P08243). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSAR | Uniprot ID | P08243 |
Uniprot Id
P08243
Target Species
Human
Target Name
ASNS
Target Full Name
Asparagine synthetase [glutamine-hydrolyzing]
Target Involvement
Asparagine synthetase deficiency (ASNSD)
Target Synonyms
asnS; ASNS_HUMAN; ASNSD; Asparagine synthetase [glutamine-hydrolyzing]; Asparagine synthetase; Cell cycle control protein TS11; Glutamine dependent asparagine synthetase 3; Glutamine dependent asparagine synthetase; Glutamine hydrolyzing; Glutamine-dependent asparagine synthetase; OTTHUMP00000024510; OTTHUMP00000204938; OTTHUMP00000204939; OTTHUMP00000204940; OTTHUMP00000204941; OTTHUMP00000204942; TS11 ; TS11 cell cycle control protein
Target Background
The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
