-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ASS1 (P00966) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ASS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ASS1 (P00966) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14011A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASS1 |
| Target Synonyms | ASS; CTLN1; ASS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Mouse testis, Rat kidney, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ASS1 (P00966). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIAR | Uniprot ID | P00966 |
Uniprot Id
P00966
Target Species
Human
Target Name
ASS1
Target Full Name
Argininosuccinate synthase
Target Function
One of the enzymes of the urea cycle, the metabolic pathway transforming neurotoxic amonia produced by protein catabolism into inocuous urea in the liver of ureotelic animals. Catalyzes the formation of arginosuccinate from aspartate, citrulline and ATP and together with ASL it is responsible for the biosynthesis of arginine in most body tissues.
Target Involvement
Citrullinemia 1 (CTLN1)
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Argininosuccinate synthase family, Type 1 subfamily
Target Tissue Specificity
Expressed in adult liver.
Target Synonyms
Argininosuccinate synthase 1; Argininosuccinate synthase; Argininosuccinate synthetase 1; ASS ; Ass-1; ass1; ASSA; ASSY_HUMAN; Citrulline aspartate ligase; Citrulline--aspartate ligase; CTLN1
Target Background
The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
Notification