Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human ATG10 (Q9H0Y0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATG10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human ATG10 (Q9H0Y0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16640A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG10 |
| Target Synonyms | APG10; APG10L; pp12616; ATG10 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, K-562, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 121-220 of human ATG10 (Q9H0Y0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP | Uniprot ID | Q9H0Y0 |
Uniprot Id
Q9H0Y0
Target Species
Human
Target Name
ATG10
Target Full Name
Ubiquitin-like-conjugating enzyme ATG10
Target Function
E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3. Plays a role in adenovirus-mediated cell lysis.
Target Subcellular Location
Cytoplasm.
Target Protein Families
ATG10 family
Target Research Area
Cell Biology
Target Synonyms
Apg 10; APG 10L; APG10; APG10 autophagy 10 like; APG10 like; APG10; S. cerevisiae; homolog of; APG10-like; APG10L; ATG 10; ATG10; ATG10 autophagy related 10 homolog (S. cerevisiae); ATG10 autophagy related 10 homolog; ATG10_HUMAN; autophagy 10; S. cerevisiae; homolog of; Autophagy related protein 10; Autophagy-related protein 10; DKFZP586I0418; FLJ13954; pp12616; Ubiquitin-like-conjugating enzyme ATG10
Target Background
Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
