Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 281-480 of human ATG13 (NP_001136145.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATG13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 281-480 of human ATG13 (NP_001136145.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12413A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG13 |
| Target Synonyms | KIAA0652; PARATARG8; ATG13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 281-480 of human ATG13 (NP_001136145.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS | Uniprot ID | O75143 |
Uniprot Id
O75143
Target Species
Human
Target Name
ATG13
Target Full Name
Autophagy-related protein 13
Target Function
Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation.
Target Subcellular Location
Cytoplasm, cytosol. Preautophagosomal structure.
Target Protein Families
ATG13 family, Metazoan subfamily
Target Synonyms
ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); ATG13_HUMAN; Autophagy related 13; Autophagy related protein 13; Autophagy-related protein 13; FLJ20698; KIAA0652; OTTHUMP00000233321; OTTHUMP00000233322; OTTHUMP00000233323; OTTHUMP00000233324; OTTHUMP00000233325; OTTHUMP00000233326
Target Background
The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
