-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG16L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-105 of human ATG16L1 (Q676U5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATG16L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-105 of human ATG16L1 (Q676U5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16462A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG16L1 |
| Target Synonyms | IBD10; WDR30; APG16L; ATG16A; ATG16L; ATG16L1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 6-105 of human ATG16L1 (Q676U5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGE | Uniprot ID | Q676U5 |
Uniprot Id
Q676U5
Target Species
Human
Target Name
ATG16L1
Target Full Name
Autophagy-related protein 16-1
Target Function
Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane. Regulates mitochondrial antiviral signaling (MAVS)-dependent type I interferon (IFN-I) production. Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response. Instead, promotes with NOD2 an autophagy-dependent antibacterial pathway. Plays a role in regulating morphology and function of Paneth cell.
Target Involvement
Inflammatory bowel disease 10 (IBD10)
Target Subcellular Location
Cytoplasm. Preautophagosomal structure membrane; Peripheral membrane protein.
Target Protein Families
WD repeat ATG16 family
Target Research Area
Cancer
Target Synonyms
A16L1_HUMAN; APG16 like 1; APG16-like 1; APG16L; APG16L beta; ATG16 autophagy related 16 like 1; ATG16 autophagy related 16-like 1 (S. cerevisiae); ATG16A; ATG16L; Atg16l1; Autophagy related protein 16 1; Autophagy-related protein 16-1; FLJ00045; FLJ10035; FLJ10828; FLJ22677; IBD10; OTTHUMP00000164391; OTTHUMP00000164393; OTTHUMP00000165876; OTTHUMP00000165877; WD repeat domain 30; WDR30
Target Background
The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.
Notification