Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG16L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ATG16L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02106A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG16L1 |
| Target Synonyms | IBD10; WDR30; APG16L; ATG16A; ATG16L; ATG16L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT | Uniprot ID | Q676U5 |
Uniprot Id
Q676U5
Target Species
Human
Target Name
ATG16L1
Target Full Name
Autophagy-related protein 16-1
Target Function
Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane. Regulates mitochondrial antiviral signaling (MAVS)-dependent type I interferon (IFN-I) production. Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response. Instead, promotes with NOD2 an autophagy-dependent antibacterial pathway. Plays a role in regulating morphology and function of Paneth cell.
Target Involvement
Inflammatory bowel disease 10 (IBD10)
Target Subcellular Location
Cytoplasm. Preautophagosomal structure membrane; Peripheral membrane protein.
Target Protein Families
WD repeat ATG16 family
Target Research Area
Cancer
Target Synonyms
A16L1_HUMAN; APG16 like 1; APG16-like 1; APG16L; APG16L beta; ATG16 autophagy related 16 like 1; ATG16 autophagy related 16-like 1 (S. cerevisiae); ATG16A; ATG16L; Atg16l1; Autophagy related protein 16 1; Autophagy-related protein 16-1; FLJ00045; FLJ10035; FLJ10828; FLJ22677; IBD10; OTTHUMP00000164391; OTTHUMP00000164393; OTTHUMP00000165876; OTTHUMP00000165877; WD repeat domain 30; WDR30
Target Background
The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
