-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apg3 (Atg3) (Q9NT62) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATG3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apg3 (Atg3) (Q9NT62) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15958A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG3 |
| Target Synonyms | APG3; APG3L; hApg3; PC3-96; APG3-LIKE; ATG3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, Mouse brain, U-87 MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apg3 (Atg3) (Q9NT62). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE | Uniprot ID | Q9NT62 |
Uniprot Id
Q9NT62
Target Species
Human
Target Name
ATG3
Target Full Name
Ubiquitin-like-conjugating enzyme ATG3
Target Function
E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.
Target Subcellular Location
Cytoplasm.
Target Protein Families
ATG3 family
Target Tissue Specificity
Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta.
Target Research Area
Apoptosis
Target Synonyms
2610016C12Rik; Apg 3; APG3; APG3 autophagy 3 like; APG3 like; APG3, S. cerevisiae, homolog of; APG3-like; APG3L; Apg3p; ATG 3; ATG3; ATG3 autophagy related 3 homolog; ATG3 autophagy related 3 homolog (S. cerevisiae); ATG3_HUMAN; Autophagy 3, S. cerevisiae, homolog of; Autophagy Apg3p/Aut1p like; autophagy related 3; Autophagy related protein 3; Autophagy-related protein 3; DKFZp564M1178; FLJ22125; hApg3; MGC15201; OTTHUMP00000214547; OTTHUMP00000214548; PC3 96; Protein PC3-96; Ubiquitin-like-conjugating enzyme ATG3
Target Background
This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification