-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG9A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human ATG9A (NP_076990.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATG9A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human ATG9A (NP_076990.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09156A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG9A |
| Target Synonyms | mATG9; APG9L1; MGD3208; ATG9A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human ATG9A (NP_076990.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI | Uniprot ID | Q7Z3C6 |
Uniprot Id
Q7Z3C6
Target Species
Human
Target Name
ATG9A
Target Full Name
Autophagy-related protein 9A
Target Function
Phospholipid scramblase involved in autophagy by mediating autophagosomal membrane expansion. Cycles between the preautophagosomal structure/phagophore assembly site (PAS) and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 (ATG2A or ATG2B) from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Also required to supply phosphatidylinositol 4-phosphate to the autophagosome initiation site by recruiting the phosphatidylinositol 4-kinase beta (PI4KB) in a process dependent on ARFIP2, but not ARFIP1. In addition to autophagy, also plays a role in necrotic cell death.
Target Subcellular Location
Preautophagosomal structure membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
ATG9 family
Target Synonyms
APG9 autophagy 9-like 1; APG9 like 1; APG9-like 1; APG9L1; ATG9; ATG9 autophagy related 9 homolog A; ATG9 autophagy related 9 homolog A (S. cerevisiae); ATG9A; ATG9A_HUMAN; Autophagy 9-like 1 protein; Autophagy related 9A; Autophagy related protein 9A; Autophagy-related protein 9A; mATG9; MGD3208; OTTHUMP00000206046; OTTHUMP00000206048; OTTHUMP00000206049; OTTHUMP00000206062
Target Background
Acts upstream of or within autophagosome assembly. Located in endosome; phagophore assembly site; and trans-Golgi network.
Notification