Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human ATL2 (NP_001129145.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ATL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human ATL2 (NP_001129145.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04764A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATL2 |
| Target Synonyms | aip-2; ARL3IP2; ARL6IP2; atlastin2; ATL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human ATL2 (NP_001129145.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY | Uniprot ID | Q8NHH9 |
Uniprot Id
Q8NHH9
Target Species
Human
Target Name
ATL2
Target Full Name
Atlastin-2
Target Function
GTPase tethering membranes through formation of trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Target Tissue Specificity
Expressed in peripheral tissues (at protein level).
Target Synonyms
ATL2; ARL6IP2; Atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; Aip-2
Target Background
Enables identical protein binding activity. Involved in Golgi organization; endoplasmic reticulum tubular network membrane organization; and protein homooligomerization. Located in endoplasmic reticulum tubular network membrane. Is integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
