Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATOH8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH8 (NP_116216.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATOH8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH8 (NP_116216.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of RT4, using ATOH8 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
| Cat.No | ADA-08226A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATOH8 |
| Target Synonyms | ATOH8; HATH6; bHLHa21; protein atonal homolog 8 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RT4 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH8 (NP_116216.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSR | Uniprot ID | Q96SQ7 |
Uniprot Id
Q96SQ7
Target Species
Human
Target Name
ATOH8
Target Full Name
Transcription factor ATOH8
Target Function
Transcription factor that binds a palindromic (canonical) core consensus DNA sequence 5'-CANNTG- 3' known as an E-box element, possibly as a heterodimer with other bHLH proteins. Regulates endothelial cell proliferation, migration and tube-like structures formation. Modulates endothelial cell differentiation through NOS3. May be implicated in specification and differentiation of neuronal cell lineages in the brain. May participate in kidney development and may be involved in podocyte differentiation. During early embryonic development is involved in tissue-specific differentiation processes that are dependent on class II bHLH factors and namely modulates the differentiation program initiated by the pro-endocrine factor NEUROG3. During myogenesis, may play a role during the transition of myoblasts from the proliferative phase to the differentiation phase. Positively regulates HAMP transcription in two ways, firstly by acting directly on the HAMP promoter via E-boxes binding and indirectly through increased phosphorylation of SMAD protein complex. Repress NEUROG3-dependent gene activation in a gene-specific manner through at least two mechanisms; requires only either the sequestering of a general partner such as TCF3 through heterodimerization, either also requires binding of the bHLH domain to DNA via a basic motif
Target Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm.
Target Tissue Specificity
Expressed in lung, liver, kidney, heart and pancreas. Expressed in endothel of umbilical vessels.
Target Synonyms
4933425C05Rik; ATOH8; ATOH8_HUMAN; Atonal homolog 6; atonal homolog 8 (Drosophila); Atonal homolog 8; Basic helix loop helix transcription factor 6; bHLHa21; Class A basic helix-loop-helix protein 21; FLJ14708; FLJ38730; hATH6; Helix loop helix protein mATH-6; Helix-loop-helix protein hATH-6; Math6; Okadin; Protein atonal homolog 8; RGD1561512
Target Background
Enables DNA-binding transcription factor activity and E-box binding activity. Involved in several processes, including SMAD protein signal transduction; positive regulation of endothelial cell differentiation; and regulation of gene expression. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
