Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13686A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATOX1 |
| Target Synonyms | ATX1; HAH1; X1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE | Uniprot ID | O00244 |
Uniprot Id
O00244
Target Species
Human
Target Name
ATOX1
Target Full Name
Copper transport protein ATOX1
Target Function
Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
Target Protein Families
ATX1 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ATOX1; ATOX1_HUMAN; ATX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 antioxidant protein 1 homolog; Copper transport protein; Copper transport protein ATOX1; HAH1; Metal transport protein; Metal transport protein ATX1; MGC138453; MGC138455
Target Background
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
