-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP1A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP_689509.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP1A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP_689509.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10018A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP1A3 |
| Target Synonyms | RDP; AHC2; CAPOS; DEE99; DYT12; ATP1A1; ATP1A3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP_689509.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE | Uniprot ID | P13637 |
Uniprot Id
P13637
Target Species
Human
Target Name
ATP1A3
Target Full Name
Sodium/potassium-transporting ATPase subunit alpha-3
Target Function
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
Target Involvement
Dystonia 12 (DYT12); Alternating hemiplegia of childhood 2 (AHC2); Cerebellar ataxia, areflexia, pes cavus, optic atrophy, and sensorineural hearing loss (CAPOS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIC subfamily
Target Synonyms
AHC2; Alpha(III); AT1A3_HUMAN; Atp1a3; ATPase Na+/K+ transporting alpha 3 polypeptide; DYT 12; DYT12; MGC13276; Na(+)/K(+) ATPase alpha(III) subunit; Na(+)/K(+) ATPase alpha-3 subunit; Na+/K+ ATPase 3; Na+/K+ ATPase alpha 3 subunit; RDP; Sodium potassium ATPase alpha 3 polypeptide; Sodium pump 3; Sodium pump subunit alpha-3; Sodium/potassium transporting ATPase alpha 3 chain; Sodium/potassium-transporting ATPase subunit alpha-3
Target Background
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification