-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP1B3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 180-279 of human ATP1B3 (P54709) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATP1B3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 180-279 of human ATP1B3 (P54709) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14256A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP1B3 |
| Target Synonyms | CD298; ATPB-3; ATP1B3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse lung, Mouse testis, Rat lung, Rat spleen, Rat testis, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 180-279 of human ATP1B3 (P54709). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA | Uniprot ID | P54709 |
Uniprot Id
P54709
Target Species
Human
Target Name
ATP1B3
Target Full Name
Sodium/potassium-transporting ATPase subunit beta-3
Target Function
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known.
Target Subcellular Location
Apical cell membrane; Single-pass type II membrane protein. Basolateral cell membrane; Single-pass type II membrane protein. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
X(+)/potassium ATPases subunit beta family
Target Synonyms
ATP1B3; Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase subunit beta-3; ATPB-3; CD antigen CD298
Target Background
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2.
Notification