-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP2B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ATP2B2 (NP_001674.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP2B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ATP2B2 (NP_001674.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02814A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP2B2 |
| Target Synonyms | PMCA2; DFNA82; PMCA2a; PMCA2i; ATP2B2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Mouse ovary, Rat liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ATP2B2 (NP_001674.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQ | Uniprot ID | Q01814 |
Uniprot Id
Q01814
Target Species
Human
Target Name
ATP2B2
Target Full Name
Plasma membrane calcium-transporting ATPase 2
Target Function
ATP-driven Ca(2+) ion pump involved in the maintenance of basal intracellular Ca(2+) levels in specialized cells of cerebellar circuit and vestibular and cochlear systems. Uses ATP as an energy source to transport cytosolic Ca(2+) ions across the plasma membrane to the extracellular compartment. Has fast activation and Ca(2+) clearance rate suited to control fast neuronal Ca(2+) dynamics. At parallel fiber to Purkinje neuron synapse, mediates presynaptic Ca(2+) efflux in response to climbing fiber-induced Ca(2+) rise. Provides for fast return of Ca(2+) concentrations back to their resting levels, ultimately contributing to long-term depression induction and motor learning. Plays an essential role in hearing and balance. In cochlear hair cells, shuttles Ca(2+) ions from stereocilia to the endolymph and dissipates Ca(2+) transients generated by the opening of the mechanoelectrical transduction channels. Regulates Ca(2+) levels in the vestibular system, where it contributes to the formation of otoconia. In non-excitable cells, regulates Ca(2+) signaling through spatial control of Ca(2+) ions extrusion and dissipation of Ca(2+) transients generated by store-operated channels. In lactating mammary gland, allows for the high content of Ca(2+) ions in the milk.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse.; [Isoform WA]: Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.; [Isoform WB]: Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.; [Isoform XB]: Basolateral cell membrane; Multi-pass membrane protein.; [Isoform ZA]: Basolateral cell membrane; Multi-pass membrane protein.; [Isoform ZB]: Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIB subfamily
Target Tissue Specificity
Mainly expressed in brain cortex. Found in low levels in skeletal muscle, heart muscle, stomach, liver, kidney and lung. Isoforms containing segment B are found in brain cortex and at low levels in other tissues. Isoforms containing segments X and W are f
Target Synonyms
AT2B2_HUMAN; atp2b2; ATPase plasma membrane Ca2+ transporting 2; Plasma membrane calcium ATPase 2; Plasma membrane calcium ATPase; Plasma membrane calcium ATPase isoform 2; Plasma membrane calcium pump isoform 2; Plasma membrane calcium transporting ATPase 2; Plasma membrane calcium-transporting ATPase 2; PMCA2; PMCA2a; PMCA2i
Target Background
The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 2. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification