-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP2B4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1141-1205 of human ATP2B4 (NP_001675.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP2B4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1141-1205 of human ATP2B4 (NP_001675.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01259A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP2B4 |
| Target Synonyms | MXRA1; PMCA4; ATP2B2; PMCA4b; PMCA4x; ATP2B4 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1141-1205 of human ATP2B4 (NP_001675.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV | Uniprot ID | P23634 |
Uniprot Id
P23634
Target Species
Human
Target Name
ATP2B4
Target Full Name
Plasma membrane calcium-transporting ATPase 4
Target Function
Calcium/calmodulin-regulated and magnesium-dependent enzyme that catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell. By regulating sperm cell calcium homeostasis, may play a role in sperm motility.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, cilium, flagellum membrane; Multi-pass membrane protein.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIB subfamily
Target Tissue Specificity
Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.
Target Synonyms
AT2B4_HUMAN; ATP2B2; Atp2b4; ATPase Ca++ transporting plasma membrane 4; Cation transporting ATPase; DKFZp686G08106; DKFZp686M088; Matrix remodelling associated 1; Matrix remodelling associated protein 1; Matrix-remodeling-associated protein 1; MXRA 1; MXRA1; OTTHUMP00000034088; OTTHUMP00000034089; Plasma membrane calcium ATPase 4; Plasma membrane calcium ATPase isoform 4; Plasma membrane calcium pump isoform 4; Plasma membrane calcium transporting ATPase 4; Plasma membrane calcium-transporting ATPase 4; PMCA 4; PMCA4; PMCA4b; PMCA4x; Sarcolemmal calcium pump
Target Background
The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification