-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP4B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 192-291 of human ATP4B (P51164) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATP4B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 192-291 of human ATP4B (P51164) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14237A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP4B |
| Target Synonyms | Hydrogen Potassium ATPase Beta; ATP4B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, HT-29, Mouse stomach, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 192-291 of human ATP4B (P51164). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK | Uniprot ID | P51164 |
Uniprot Id
P51164
Target Species
Human
Target Name
ATP4B
Target Full Name
Potassium-transporting ATPase subunit beta
Target Function
The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.
Target Subcellular Location
Apical cell membrane; Single-pass type II membrane protein. Cell membrane; Single-pass type II membrane protein.
Target Protein Families
X(+)/potassium ATPases subunit beta family
Target Research Area
Transport, Signal Transduction
Target Synonyms
Gastric H(+)/K(+) ATPase subunit beta; ATP4B; ATP4B_HUMAN; ATP6B; ATPase H+/K+ exchanging beta polypeptide; ATPase H+/K+ transporting beta polypeptide; Gastric H K ATPase catalytic subunit; Gastric H(+)/K(+) ATPase subunit beta; Gastric H+/K+ ATPase beta subunit; Gastric hydrogen potassium ATPase; Gastric hydrogen potassium ATPase beta; Hydrogen/potassium exchanging ATPase 4B; OTTHUMP00000178856; Parietal cell antigen; Potassium transporting ATPase beta chain; Potassium transporting ATPase subunit beta; Potassium-transporting ATPase subunit beta; Proton pump; Proton pump beta chain
Target Background
The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
Notification