Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP5J2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-94 of human ATP5J2 (NP_004880.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP5J2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-94 of human ATP5J2 (NP_004880.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05469A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP5J2 |
| Target Synonyms | ATP5J2; ATP5JL | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-94 of human ATP5J2 (NP_004880.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH | Uniprot ID | P56134 |
Uniprot Id
P56134
Target Species
Human
Target Name
ATP5MF
Target Full Name
ATP synthase subunit f, mitochondrial
Target Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane
Target Subcellular Location
Mitochondrion. Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
ATPase F chain family
Target Synonyms
ATP5MF; ATP5J2; ATP5JL; ATP synthase subunit f, mitochondrial; ATP synthase membrane subunit f
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
