-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP5O was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-213 of human ATP5O (NP_001688.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ATP5O was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-213 of human ATP5O (NP_001688.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00035A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP5O |
| Target Synonyms | ATPO; OSCP; ATP5O; HMC08D05 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, A-549, MCF-7, Mouse liver, Mouse lung, NCI-H460, SKOV3, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-213 of human ATP5O (NP_001688.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV | Uniprot ID | P48047 |
Uniprot Id
P48047
Target Species
Human
Target Name
ATP5PO
Target Full Name
ATP synthase subunit O, mitochondrial
Target Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
Target Subcellular Location
Mitochondrion. Mitochondrion inner membrane.
Target Protein Families
ATPase delta chain family
Target Research Area
Metabolism
Target Synonyms
ATP synthase O subunit mitochondrial precursor; ATP synthase subunit O; ATP synthase; H+ transporting; mitochondrial F1 complex; O subunit; ATP5O; ATPO; ATPO_HUMAN; mitochondrial; Mitochondrial ATP synthase; O subunit ; Oligomycin sensitivity conferral protein; OSCP
Target Background
The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
Notification