-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6V1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP6V1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05498A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6V1A |
| Target Synonyms | HO68; VA68; VPP2; Vma1; DEE93; ARCL2D; ATP6A1; IECEE3; ATP6V1A1; ATP6V1A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD | Uniprot ID | P38606 |
Uniprot Id
P38606
Target Species
Human
Target Name
ATP6V1A
Target Full Name
V-type proton ATPase catalytic subunit A
Target Function
Catalytic subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. May play a role in neurite development and synaptic connectivity.; (Microbial infection) Plays an important role in virion uncoating during Rabies virus replication after membrane fusion. Specifically, participates in the dissociation of incoming viral matrix M proteins uncoating through direct interaction.
Target Involvement
Cutis laxa, autosomal recessive, 2D (ARCL2D)
Target Subcellular Location
Cytoplasm. Cytoplasmic vesicle, secretory vesicle.
Target Protein Families
ATPase alpha/beta chains family
Target Tissue Specificity
High expression in the skin.
Target Synonyms
70kDa subunit; ATP6A1; ATP6V1A; ATP6V1A1; ATPase H+ transporting lysosomal subunit A1; ATPase H+ transporting; lysosomal 70kDa V1 subunit A; H(+) transporting two sector ATPase subunit A; H+ transporting ATPase chain A vacuolar (VA68 type); HO68; OTTHUMP00000214746; V ATPase 69 kDa subunit 1; V ATPase A subunit 1; V ATPase subunit A 1; V-ATPase 69 kDa subunit; V-ATPase subunit A; V-type proton ATPase catalytic subunit A; VA68; Vacuolar ATP synthase catalytic subunit A ubiquitous isoform; Vacuolar ATPase isoform VA68; Vacuolar proton pump alpha subunit 1; Vacuolar proton pump subunit alpha; VATA_HUMAN; Vma1; VPP2
Target Background
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.
Notification