-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6V1C1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATP6V1C1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06856A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6V1C1 |
| Target Synonyms | VATC; Vma5; ATP6C; ATP6D; ATP6V1C1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK | Uniprot ID | P21283 |
Uniprot Id
P21283
Target Species
Human
Target Name
ATP6V1C1
Target Full Name
V-type proton ATPase subunit C 1
Target Function
Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Target Protein Families
V-ATPase C subunit family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ATP6C; ATP6D; ATP6V1C1; ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD; ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C1; ATPase H+ transporting lysosomal V1 subunit C1; FLJ20057; H(+) transporting two sector ATPase subunit C; H+ ATPase C subunit; H+ transporting ATPase chain C vacuolar; Subunit C of vacuolar proton ATPase V1 domain; V ATPase C subunit; V ATPase subunit C 1; V-ATPase subunit C 1; V-type proton ATPase subunit C 1; Vacuolar ATP synthase subunit C; Vacuolar proton pump 42 kD subunit; Vacuolar proton pump C subunit; Vacuolar proton pump subunit C 1; Vacuolar protonATPase subunit C VI domain; VATC; VATC1_HUMAN; VATPase C subunit; VATPase subunit C 1; VMA5
Target Background
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.
Notification