-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6V1G2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATP6V1G2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07387A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6V1G2 |
| Target Synonyms | NG38; ATP6G; VMA10; ATP6G2; ATP6V1G2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse eye, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL | Uniprot ID | O95670 |
Uniprot Id
O95670
Target Species
Human
Target Name
ATP6V1G2
Target Full Name
V-type proton ATPase subunit G 2
Target Function
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Target Subcellular Location
Melanosome. Note=Highly enriched in late-stage melanosomes.
Target Protein Families
V-ATPase G subunit family
Target Tissue Specificity
Brain.
Target Synonyms
ATP6G; ATP6G2; ATP6V1G2; ATPase H+ transporting lysosomal (vacuolar proton pump) subunit G; ATPase H+ transporting lysosomal 13kDa V1 subunit G2; H(+) transporting two sector ATPase subunit G2; NG 38; NG38; OTTHUMP00000036058; OTTHUMP00000036060; V ATPase 13 kDa subunit 2; V ATPase G subunit 2; V ATPase subunit G 2; V-ATPase 13 kDa subunit 2; V-ATPase subunit G 2; V-type proton ATPase subunit G 2; Vacuolar ATP synthase subunit G 2; Vacuolar proton pump G subunit 2; Vacuolar proton pump subunit G 2; VATG2_HUMAN; VMA 10; VMA10
Target Background
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. Read-through transcription also exists between this gene and the downstream DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B (DDX39B) gene.
Notification