-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1251-1351 of human ATP7B (NP_001230111.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATP7B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1251-1351 of human ATP7B (NP_001230111.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09662A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP7B |
| Target Synonyms | WD; PWD; WC1; WND; ATP7B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1251-1351 of human ATP7B (NP_001230111.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEE | Uniprot ID | P35670 |
Uniprot Id
P35670
Target Species
Human
Target Name
ATP7B
Target Full Name
Copper-transporting ATPase 2
Target Function
Copper ion transmembrane transporter involved in the export of copper out of the cells. It is involved in copper homeostasis in the liver, where it ensures the efflux of copper from hepatocytes into the bile in response to copper overload.
Target Involvement
Wilson disease (WD)
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Late endosome.; [Isoform 1]: Golgi apparatus membrane; Multi-pass membrane protein.; [Isoform 2]: Cytoplasm.; [WND/140 kDa]: Mitochondrion.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IB subfamily
Target Tissue Specificity
Most abundant in liver and kidney and also found in brain. Isoform 2 is expressed in brain but not in liver. The cleaved form WND/140 kDa is found in liver cell lines and other tissues.
Target Research Area
Metabolism
Target Synonyms
ATP7B; ATP7B_HUMAN; ATPase, Cu(2+) transporting, beta polypeptide; ATPase, Cu++ transporting, beta polypeptide; Copper pump 2; Copper transporting ATPase 2; PWD; Toxic milk; tx; WC1; WD; Wilson disease associated protein; Wilson disease-associated protein; WND; WND/140 kDa
Target Background
This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein is a monomer, and functions as a copper-transporting ATPase which exports copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease which is characterized by copper accumulation.
Notification