Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATPIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ATPIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of various lysates, using ATPIF1 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.
| Cat.No | ADA-15543A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATPIF1 |
| Target Synonyms | IP; ATPI; ATPIP; ATPIF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD | Uniprot ID | Q9UII2 |
Uniprot Id
Q9UII2
Target Species
Human
Target Name
ATP5IF1
Target Full Name
ATPase inhibitor, mitochondrial
Target Function
Endogenous F(1)F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F(1)F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix. Required to avoid the consumption of cellular ATP when the F(1)F(o)-ATP synthase enzyme acts as an ATP hydrolase. Indirectly acts as a regulator of heme synthesis in erythroid tissues: regulates heme synthesis by modulating the mitochondrial pH and redox potential, allowing FECH to efficiently catalyze the incorporation of iron into protoporphyrin IX to produce heme.
Target Subcellular Location
Mitochondrion.
Target Protein Families
ATPase inhibitor family
Target Synonyms
ATIF1_HUMAN; ATP synthase inhibitor protein; ATPase inhibitor; ATPase inhibitor mitochondrial; ATPase inhibitor protein; ATPase inhibitory factor 1; ATPI; ATPIF 1; Atpif1; ATPIP; IF(1); IF1; Inhibitor of F(1)F(o)-ATPase; IP; MGC1167; MGC8898; mitochondrial
Target Background
Enables several functions, including ATPase binding activity; angiostatin binding activity; and mitochondrial proton-transporting ATP synthase complex binding activity. Involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Located in cell surface and mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
