-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATRX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2100-2200 of human ATRX (NP_000480.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATRX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2100-2200 of human ATRX (NP_000480.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06725A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATRX |
| Target Synonyms | JMS; XH2; XNP; MRX52; RAD54; RAD54L; ZNF-HX; ATRX | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2100-2200 of human ATRX (NP_000480.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFT | Uniprot ID | P46100 |
Uniprot Id
P46100
Target Species
Human
Target Name
ATRX
Target Full Name
Transcriptional regulator ATRX
Target Function
Involved in transcriptional regulation and chromatin remodeling. Facilitates DNA replication in multiple cellular environments and is required for efficient replication of a subset of genomic loci. Binds to DNA tandem repeat sequences in both telomeres and euchromatin and in vitro binds DNA quadruplex structures. May help stabilizing G-rich regions into regular chromatin structures by remodeling G4 DNA and incorporating H3.3-containing nucleosomes. Catalytic component of the chromatin remodeling complex ATRX:DAXX which has ATP-dependent DNA translocase activity and catalyzes the replication-independent deposition of histone H3.3 in pericentric DNA repeats outside S-phase and telomeres, and the in vitro remodeling of H3.3-containing nucleosomes. Its heterochromatin targeting is proposed to involve a combinatorial readout of histone H3 modifications (specifically methylation states of H3K9 and H3K4) and association with CBX5. Involved in maintaining telomere structural integrity in embryonic stem cells which probably implies recruitment of CBX5 to telomeres. Reports on the involvement in transcriptional regulation of telomeric repeat-containing RNA (TERRA) are conflicting; according to a report, it is not sufficient to decrease chromatin condensation at telomeres nor to increase expression of telomeric RNA in fibroblasts. May be involved in telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines. Acts as negative regulator of chromatin incorporation of transcriptionally repressive histone MACROH2A1, particularily at telomeres and the alpha-globin cluster in erythroleukemic cells. Participates in the allele-specific gene expression at the imprinted IGF2/H19 gene locus. On the maternal allele, required for the chromatin occupancy of SMC1 and CTCTF within the H19 imprinting control region (ICR) and involved in esatblishment of histone tails modifications in the ICR. May be involved in brain development and facial morphogenesis. Binds to zinc-finger coding genes with atypical chromatin signatures and regulates its H3K9me3 levels. Forms a complex with ZNF274, TRIM28 and SETDB1 to facilitate the deposition and maintenance of H3K9me3 at the 3' exons of zinc-finger genes.
Target Involvement
Alpha-thalassemia mental retardation syndrome, X-linked (ATRX); Mental retardation, X-linked, syndromic, with hypotonic facies 1 (MRXSHF1); Alpha-thalassemia myelodysplasia syndrome (ATMDS)
Target Subcellular Location
Nucleus. Chromosome, telomere. Nucleus, PML body.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Alpha thalassemia/mental retardation syndrome X linked homolog; ATP dependent helicase ATRX; ATP-dependent helicase ATRX; ATR2; Atrx; ATRX_HUMAN; DNA dependent ATPase and helicase; Helicase 2; X linked; MGC2094; MRXHF1; RAD54; RAD54L; SFM1; SHS; Transcriptional regulator ATRX; X linked helicase II; X linked nuclear protein; X-linked helicase II; X-linked nuclear protein; XH2; XNP; Znf HX; Znf-HX
Target Background
The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Mutations in this gene are associated with X-linked syndromes exhibiting cognitive disabilities as well as alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Notification