-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Aurora B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Aurora B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07165A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aurora B |
| Target Synonyms | AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2; Aurora B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH | Uniprot ID | Q96GD4 |
Uniprot Id
Q96GD4
Target Species
Human
Target Name
AURKB
Target Full Name
Aurora kinase B
Target Function
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Involved in the bipolar attachment of spindle microtubules to kinetochores and is a key regulator for the onset of cytokinesis during mitosis. Required for central/midzone spindle assembly and cleavage furrow formation. Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: phosphorylates CHMP4C, leading to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. AURKB phosphorylates the CPC complex subunits BIRC5/survivin, CDCA8/borealin and INCENP. Phosphorylation of INCENP leads to increased AURKB activity. Other known AURKB substrates involved in centromeric functions and mitosis are CENPA, DES/desmin, GPAF, KIF2C, NSUN2, RACGAP1, SEPTIN1, VIM/vimentin, HASPIN, and histone H3. A positive feedback loop involving HASPIN and AURKB contributes to localization of CPC to centromeres. Phosphorylation of VIM controls vimentin filament segregation in cytokinetic process, whereas histone H3 is phosphorylated at 'Ser-10' and 'Ser-28' during mitosis (H3S10ph and H3S28ph, respectively). A positive feedback between HASPIN and AURKB contributes to CPC localization. AURKB is also required for kinetochore localization of BUB1 and SGO1. Phosphorylation of p53/TP53 negatively regulates its transcriptional activity. Key regulator of active promoters in resting B- and T-lymphocytes: acts by mediating phosphorylation of H3S28ph at active promoters in resting B-cells, inhibiting RNF2/RING1B-mediated ubiquitination of histone H2A and enhancing binding and activity of the USP16 deubiquitinase at transcribed genes.
Target Involvement
Disruptive regulation of expression is a possible mechanism of the perturbation of chromosomal integrity in cancer cells through its dominant-negative effect on cytokinesis.
Target Subcellular Location
Nucleus. Chromosome. Chromosome, centromere. Cytoplasm, cytoskeleton, spindle. Midbody.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, Aurora subfamily
Target Tissue Specificity
High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase.
Target Synonyms
AIK2; AIM-1; AIM1; ARK-2; ARK2; AurB; AURKB; AURKB_HUMAN; Aurora 1; Aurora and Ipl1 like midbody associated protein 1; Aurora kinase B; Aurora related kinase 2; Aurora- and Ipl1-like midbody-associated protein 1; Aurora-B; Aurora-related kinase 2; Aurora/IPL1 related kinase 2; Aurora/IPL1-related kinase 2; IPL1; PPP1R48; Protein phosphatase 1 regulatory subunit 48; Serine/theronine kinase 12; Serine/threonine protein kinase 12; Serine/threonine-protein kinase 12; Serine/threonine-protein kinase aurora-B; STK-1; STK1; STK12; STK5
Target Background
This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.
Notification