Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AVPR1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human AVPR1A (NP_000697.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AVPR1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human AVPR1A (NP_000697.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01394A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AVPR1A |
| Target Synonyms | V1aR; AVPR1; AVPR V1a; AVPR1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human AVPR1A (NP_000697.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST | Uniprot ID | P37288 |
Uniprot Id
P37288
Target Species
Human
Target Name
AVPR1A
Target Full Name
Vasopressin V1a receptor
Target Function
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Target Synonyms
Antidiuretic hormone receptor 1a; Arginine vasopressin receptor 1A; AVPR 1; AVPR 1A; AVPR V1a; AVPR1; AVPR1A; SCCL vasopressin subtype 1a receptor; V1 vascular vasopressin receptor AVPR1A; V1a vasopressin receptor; V1aR; V1AR_HUMAN; Vascular/hepatic type arginine vasopressin receptor; Vascular/hepatic-type arginine vasopressin receptor; Vasopressin V1a receptor
Target Background
The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
