-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AVPR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 232-371 of human AVPR2 (NP_000045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AVPR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 232-371 of human AVPR2 (NP_000045.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01893A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AVPR2 |
| Target Synonyms | DI1; DIR; NDI; V2R; ADHR; DIR3; NDI1; AVPR2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, COS-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 232-371 of human AVPR2 (NP_000045.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS | Uniprot ID | P30518 |
Uniprot Id
P30518
Target Species
Human
Target Name
AVPR2
Target Full Name
Vasopressin V2 receptor
Target Function
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.
Target Involvement
Nephrogenic syndrome of inappropriate antidiuresis (NSIAD); Diabetes insipidus, nephrogenic, X-linked (XNDI)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Target Tissue Specificity
Kidney.
Target Synonyms
ADHR; Antidiuretic hormone receptor; Arginine vasopressin receptor 2; AVP R2; AVPR 2; AVPR V2; AVPR2; DI1; DIR 3; DIR; DIR3; MGC126533; MGC138386; NDI; Nephrogenic diabetes insipidus; Renal type arginine vasopressin receptor; Renal-type arginine vasopressin receptor; V2 receptor; V2R; V2R_HUMAN; Vasopressin V2; Vasopressin V2 receptor
Target Background
This gene encodes the vasopressin receptor, type 2, also known as the V2 receptor, which belongs to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily, and couples to Gs thus stimulating adenylate cyclase. The subfamily that includes the V2 receptor, the V1a and V1b vasopressin receptors, the oxytocin receptor, and isotocin and mesotocin receptors in non-mammals, is well conserved, though several members signal via other G proteins. All bind similar cyclic nonapeptide hormones. The V2 receptor is expressed in the kidney tubule, predominantly in the distal convoluted tubule and collecting ducts, where its primary property is to respond to the pituitary hormone arginine vasopressin (AVP) by stimulating mechanisms that concentrate the urine and maintain water homeostasis in the organism. When the function of this gene is lost, the disease Nephrogenic Diabetes Insipidus (NDI) results. The V2 receptor is also expressed outside the kidney although its tissue localization is uncertain. When these 'extrarenal receptors' are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known - its absence does not appear to be detrimental in NDI patients. The gene expression has also been described in fetal lung tissue and lung cancer associated with alternative splicing.
Notification