Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AXIN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human AXIN2 (NP_004646.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against AXIN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human AXIN2 (NP_004646.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of 293T cells using AXIN2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-07818A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AXIN2 |
| Target Synonyms | AXIL; ODCRCS; AXIN2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human AXIN2 (NP_004646.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGN | Uniprot ID | Q9Y2T1 |
Uniprot Id
Q9Y2T1
Target Species
Human
Target Name
AXIN2
Target Full Name
Axin-2
Target Function
Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B.
Target Involvement
Colorectal cancer (CRC); Oligodontia-colorectal cancer syndrome (ODCRCS)
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expressed in brain and lymphoblast.
Target Research Area
Cancer
Target Synonyms
Axil; Axin like protein; Axin-2; Axin-like protein; Axin2; AXIN2_HUMAN; Axis inhibition protein 2; Conductin; DKFZp781B0869; MGC10366; MGC126582
Target Background
The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
