Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against B3GNT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human B3GNT3 (NP_055071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against B3GNT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human B3GNT3 (NP_055071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10509A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | B3GNT3 |
| Target Synonyms | TMEM3; B3GN-T3; B3GNT-3; HP10328; B3GAL-T8; beta3Gn-T3; B3GNT3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse stomach, SGC-7901 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human B3GNT3 (NP_055071.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFVGQLIQ | Uniprot ID | Q9Y2A9 |
Uniprot Id
Q9Y2A9
Target Species
Human
Target Name
B3GNT3
Target Full Name
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
Target Function
Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Has activity for type 2 oligosaccharides. Also acts as a core1-1,3-N-acetylglucosaminyltransferase (Core1-beta3GlcNAcT) to form the 6-sulfo sialyl Lewis x on extended core1 O-glycans.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 31 family
Target Tissue Specificity
Expressed in colon, jejunum, stomach, esophagus, placenta and trachea.
Target Synonyms
B3GNT3; B3GALT8; TMEM3; UNQ637/PRO1266N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3; EC 2.4.1.149; Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase; EC 2.4.1.146; Beta-1,3-galactosyltransferase 8; Beta-1,3-GalTase 8; Beta3Gal-T8; Beta3GalT8; b3Gal-T8; Beta-3-Gx-T8; Core 1 extending beta-1,3-N-acetylglucosaminyltransferase; Core1-beta3GlcNAcT; Transmembrane protein 3; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3; BGnT-3; Beta-1,3-Gn-T3; Beta-1,3-N-acetylglucosaminyltransferase 3; Beta3Gn-T3; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8
Target Background
This gene encodes a member of the beta-1, 3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
