-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BACE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 402-501 of human BACE1 (P56817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BACE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 402-501 of human BACE1 (P56817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16808A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BACE1 |
| Target Synonyms | ASP2; BACE; HSPC104; BACE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 402-501 of human BACE1 (P56817). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK | Uniprot ID | P56817 |
Uniprot Id
P56817
Target Species
Human
Target Name
BACE1
Target Full Name
Beta-secretase 1
Target Function
Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase. Cleaves CHL1.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network. Endoplasmic reticulum. Endosome. Cell surface. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane raft. Lysosome. Late endosome. Early endosome. Recycling endosome. Cell projection, axon. Cell projection, dendrite.
Target Protein Families
Peptidase A1 family
Target Tissue Specificity
Expressed at high levels in the brain and pancreas. In the brain, expression is highest in the substantia nigra, locus coruleus and medulla oblongata.
Target Synonyms
BACE1; BACE; KIAA1149; Beta-secretase 1; Aspartyl protease 2; ASP2; Asp 2; Beta-site amyloid precursor protein cleaving enzyme 1; Beta-site APP cleaving enzyme 1; Memapsin-2; Membrane-associated aspartic protease 2
Target Background
This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients.
Notification