-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAF57/SMARCE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BAF57/SMARCE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13816A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAF57/SMARCE1 |
| Target Synonyms | CSS5; BAF57; BAF57/SMARCE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Jurkat, MCF7, Mouse brain, Mouse spinal cord | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII | Uniprot ID | Q969G3 |
Uniprot Id
Q969G3
Target Species
Human
Target Name
SMARCE1
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Target Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Required for the coactivation of estrogen responsive promoters by SWI/SNF complexes and the SRC/p160 family of histone acetyltransferases (HATs). Also specifically interacts with the CoREST corepressor resulting in repression of neuronal specific gene promoters in non-neuronal cells.
Target Involvement
Meningioma (MNGMA); Coffin-Siris syndrome 5 (CSS5)
Target Subcellular Location
Nucleus.
Target Synonyms
BAF57; BRG1 associated factor 57; BRG1-associated factor 57; Chromatin remodeling complex BRG1 associated factor 57; FLJ35648; SMARCE 1; SMARCE1; SMCE1_HUMAN; SWI/SNF related matrix associated actin dependent regulator of chromatin e1; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily e member 1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Target Background
The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.
Notification