-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAG3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human BAG3 (O95817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BAG3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human BAG3 (O95817) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13899A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAG3 |
| Target Synonyms | BIS; MFM6; BAG-3; CAIR-1; BAG3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BAG3 (O95817). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NDPRVPSEGPKETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQ | Uniprot ID | O95817 |
Uniprot Id
O95817
Target Species
Human
Target Name
BAG3
Target Full Name
BAG family molecular chaperone regulator 3
Target Function
Co-chaperone for HSP70 and HSC70 chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting the release of ADP from the HSP70 and HSC70 proteins thereby triggering client/substrate protein release. Nucleotide release is mediated via its binding to the nucleotide-binding domain (NBD) of HSPA8/HSC70 where as the substrate release is mediated via its binding to the substrate-binding domain (SBD) of HSPA8/HSC70. Has anti-apoptotic activity. Plays a role in the HSF1 nucleocytoplasmic transport.
Target Involvement
Myopathy, myofibrillar, 6 (MFM6); Cardiomyopathy, dilated 1HH (CMD1HH)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Synonyms
BAG 3; BAG family molecular chaperone regulator 3; BAG-3; Bag3; BAG3_HUMAN; Bcl 2 binding protein; Bcl-2-associated athanogene 3; Bcl-2-binding protein Bis; BCL2 associated athanogene 3; BCL2 binding athanogene 3; BIS; CAIR 1; Docking protein CAIR 1; Docking protein CAIR-1; MFM6
Target Background
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
Notification