-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAIAP2L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 198-388 of human BAIAP2L1 (NP_061330.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BAIAP2L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 198-388 of human BAIAP2L1 (NP_061330.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01577A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAIAP2L1 |
| Target Synonyms | IRTKS; BAIAP2L1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-549, HepG2, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 198-388 of human BAIAP2L1 (NP_061330.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKA | Uniprot ID | Q9UHR4 |
Uniprot Id
Q9UHR4
Target Species
Human
Target Name
BAIAP2L1
Target Full Name
BAR/IMD domain-containing adapter protein 2-like 1
Target Function
May function as adapter protein. Involved in the formation of clusters of actin bundles. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection.
Target Subcellular Location
Cytoplasm, cytoskeleton. Note=Recruited to actin pedestals that are formed upon infection by bacteria at bacterial attachment sites.
Target Synonyms
BAI1 associated protein 2 like 1; BAI1 associated protein 2 like protein 1; BAI1-associated protein 2-like protein 1; Baiap2l1; BI2L1_HUMAN; Brain specific angiogenesis inhibitor 1 associated protein 2 like protein 1; Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1; FLJ42275; Insulin receptor tyrosine kinase substrate; IRTKS
Target Background
This gene encodes a member of the IMD (IRSp53/MIM homology domain) family. Members of this family can be subdivided in two groups, the IRSp53-like and MIM-like, based on the presence or absence of the SH3 (Src homology 3) domain. The protein encoded by this gene contains a conserved IMD, also known as F-actin bundling domain, at the N-terminus, and a canonical SH3 domain near the C-terminus, so it belongs to the IRSp53-like group. This protein is the substrate for insulin receptor tyrosine kinase and binds to the small GTPase Rac. It is involved in signal transduction pathways that link deformation of the plasma membrane and remodeling of the actin cytoskeleton. It also promotes actin assembly and membrane protrusions when overexpressed in mammalian cells, and is essential to the formation of a potent actin assembly complex during EHEC (Enterohemorrhagic Escherichia coli) pedestal formation.
Notification